PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g19610.9.p
Common NameBRADI_2g19610, LOC100827663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-PHD
Protein Properties Length: 975aa    MW: 106833 Da    PI: 4.6314
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g19610.9.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox391.3e-12784836456
                       -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       R++f +   ++L e+F+ ++yp+++ +e LA++lgLt +qV+ WF  rR+k +
  Bradi2g19610.9.p 784 RRQFGPIIYQRLHEHFKTDQYPKRAVKESLANELGLTFQQVSKWFETRRYKTR 836
                       7778888889*****************************************87 PP

2PHD39.99.6e-14226281151
                       SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
               PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                       +C+ C++   + +++++lCdg C++ fH+kCl+++l ++++p g   wlC+ C++k
  Bradi2g19610.9.p 226 ICATCSSqyVTLNNDIILCDGvCDRGFHQKCLNPPLLTKDIPAGdeGWLCPACDCK 281
                       6******87667********77********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579031.35E-12220284IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.105.6E-12223280IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.923224281IPR019787Zinc finger, PHD-finger
SMARTSM002492.0E-10226279IPR001965Zinc finger, PHD-type
PfamPF006281.2E-10226281IPR019787Zinc finger, PHD-finger
CDDcd155047.84E-24227278No hitNo description
PROSITE patternPS013590227278IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007114.107778838IPR001356Homeobox domain
SMARTSM003894.3E-10780842IPR001356Homeobox domain
SuperFamilySSF466898.13E-12783843IPR009057Homeodomain-like
CDDcd000862.88E-11783836No hitNo description
Gene3DG3DSA:1.10.10.604.9E-12784843IPR009057Homeodomain-like
PfamPF000464.7E-10784836IPR001356Homeobox domain
PROSITE patternPS000270813836IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 975 aa     Download sequence    Send to blast
MDMNKGTGSG CAEDNVETGN YANSSQNPET LDNQSLPYTS QSLENNTGQR KNYKRTANRG  60
RKGYRVLADR NYPLRSSDCD TTVRVLRSRS AANKPPSDSA HTLVHSAANK FPSDSVHTLV  120
QPAAKRIKRG RPTKKGPNNE FSKIRQRVRY ILNRMNYEQS LLEAYANEGW KRQRPEKELE  180
RAKEEIVRCK LRIREAFQNL DSLLSMGKLD ESLFDNEGKI SCEDIICATC SSQYVTLNND  240
IILCDGVCDR GFHQKCLNPP LLTKDIPAGD EGWLCPACDC KIDCIDVINE LQGTNLSISD  300
SWEKVFPETA ALAHGTIPKD AFDLPSEDSE DSDFDPNIAE EHVTGHEEGS SEEDEDEGSD  360
SDDSNFVTTC DNSEHLKEKE KVDDLGLPSE DSEDDDYDPA GPDSDKDIKE KQDESDFTSD  420
SDDFCAEIAK SCGRDEVSSG AKVGDPTNDL EGATACSNTA IPNLTSNDLE IDQDEVLPVL  480
GRRQGQRLDY KKLYDDAYGE APSDSSDGEE WSGKSTSEKG DEERNEVDSF LRKSSRGTGT  540
VQQSNDFLPQ SARQSLDPDG LVNGQHPGKL TSDVSNNKTN RKPLNNKEEV DDLGLPSEDS  600
EDDDYDPAGP DSDKDIEKKQ SSSNESDYSS ASDDFCGEIA KSCGREGVPS GAKAGGHPTN  660
DLEGTTVRTN AAISNLPSKD SQMDQDVVSP VSGRRQDQSL DCKKLYDEAC REASSDSSDG  720
EDWSGKCTPE KDSEKQSDTC RRTGAVRQSN GSTPDNARQS LHRTNGQHTE ELLTSDGSSS  780
TVHRRQFGPI IYQRLHEHFK TDQYPKRAVK ESLANELGLT FQQVSKWFET RRYKTRIAAK  840
KNDSCVKNHS IKENQSSVAA HIEATDPKDL GKKLNVCKNG AANDVMASGI LNGGIKQDSP  900
LKQDTSGGLG THVSPPGSSP KGDPIENHGN NTSSRCVGKP KDGYTGNVVL ALPVVDDRTK  960
EAAMRELKKR KTGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231157.10.0PREDICTED: homeobox protein HOX1A-like isoform X1
RefseqXP_014754573.10.0PREDICTED: homeobox protein HOX1A-like isoform X1
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLA0A0Q3IY470.0A0A0Q3IY47_BRADI; Uncharacterized protein
STRINGBRADI2G19610.20.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.15e-73Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain